taxonID	type	description	language	source
03CB878E65285132FD7EFCA28117BA85.taxon	diagnosis	Diagnosis. Idiosomawide, oval. Theslitbetweenperitrematalshields anddorsalshieldsnarrow, posterolateraltipsofperitrematalshieldstruncate. Peritremesofgeneralsize, expandedtoanteriorhalfofcoxaeIII, straightor bent. Setaer 1 andr 3 shiftedventrallytoperitrematalshields, bothshort, bris- tle-like, smoothorbarbed. Glands gv 2 present, theiropeningssurroundedby smalladgenitalsclerites. Ventrianalshieldwide, withtwodeep, verticalinci- sionsinitsanterolateralregion. Anterolateraledgeofventrianalshieldnearly reachingposteriormarginofperitrematalshields, inmalestheseshieldsmay befusedwitheachother. Ventrianalshieldbearing 19 setae, setaeZv 1 absent. Glands gv 3 situated anterolateral or lateral to adanal setae. Setae z 1 absent. ThirdpairofopisthonotalporesassociatedwiththeJ-series (inposition gdJ 2 or gdJ 3). Marginofopisthonotumwith 7 pairsofR-setae. SetaeS 1 andanterior R-setae (R 1 – 2) significantlylongerthantherestofR-setae. Posterodorsalcavi- tieswell-sclerotized, ofmoderatesize.	en	Ujvári, Zs. (2013): Review Of The Nearctic Genera Macrozercon Błaszak, 1976 And Microzercon Błaszak, 1976 (Mesostigmata: Zerconidae). Acta Zoologica Academiae Scientiarum Hungaricae 59 (4): 347-389, DOI: 10.5281/zenodo.5736238
03CB878E652E513FFDBAFCAC80A4BD39.taxon	description	(Figs 15 – 26) Type material. Holotype: female – USA, Washington, Wenatchee county, Pinetum, small pond, leaf litter, 18.09.1978, leg. Jermy, T. (HNHM E-Am- 080). Paratypes: 7 females, 5 males, 1 deutonymph – locality and date as for the holotype (HNHM E-Am- 080). Diagnosisoffemale. Mostcentralandsubmarginalpodonotalsetae smoothorfinelyserrate. MarginalsetaeS 1 andR 1 – 2 elongate, brush-like, R 3 – 7 short, smooth, bristle-like. GlandsPo 2 situatedinposition gdS 2, online connectingS 2 andS 3, Po 3 situatedinposition gdJ 3, posterolateraltoJ 3. Anterocentralandlateralsurfaceofpodonotumcoveredbyscalespossessing lacyposteriormargin. Peritremesnearlystraight, withasmalldilationnear stigmata. Descriptionoffemale. Lengthofidiosoma: 462 μm (451 – 483 μm); width: 376 μm (355 – 398 μm) (n = 8). Dorsal side (Fig. 15). Podonotum with 20 pairs of setae, j 1 – 6, z 2 – 6, s 1 – 6, r 2 and r 4 – 5 inserteddorsally, r 1 andr 3 insertedventrally, onperitrematalshields. Setaej 1, z 3, r 2, s 3, r 4 – 5 ands 6 elongate, brush-like, denselypilose. Setaej 2, j 6, z 6, s 2 ands 4 – 5 shorter, finely serrate. Otherpodonotalsetaeshort, smoothandneedle-like. Setaes 5 situatednearlevel ofz 6. Glands gds 1 (po 1) situatedmedialoranteromedialtoinsertionsofs 1; gdj 4 (po 2) situated on line connecting j 4 and z 4, near z 4; gds 4 (po 3) on line connecting s 4 and s 5. Anterocentralandlateralsurfaceofpodonotalshieldcoveredbyscalespossessinglacyposterior margin, posterocentralpodonotalsurfacesmooth. Opisthonotumwith 22 pairsofsetae: J 1 – 5, Z 1 – 5 andS 1 – 5, marginalR-serieswith sevenpairsofsetae. SetaeJ 1 – 5, Z 1 – 4 andS 2 – 3 similarinappearance, moderatelylong, pointed, denselypilose (Fig. 19). SetaeJ 1 – 5 andZ 1 – 4 constitutenearlyparallellines. Setae S 2 situatedanteriortoS 3. SetaeZ 5 andS 4 – 5 elongate, apicallybroadening, brush-like. S 2 – 3 notreachingedgesofopisthonotum, S 4 – 5 expandingbeyondthemarginsoftheshield. SetaeS 1 andR 1 – 2 similarinappearance, brush-like, longerthantherestofR-setae. R 3 – 7 short, smooth, bristle-like, R 3 maybefinelybarbed. Lengthofopisthonotalsetaeanddis- tancesbetweentheirinsertionsasinTable 2. Glands gdZ 1 (Po 1) situatedanteromedialto insertionsofZ 1; gdS 2 (Po 2) situatedonlineconnectingS 2 andS 3; gdJ 3 (Po 3) posterolateral toJ 3; gdS 5 (Po 4) onlineconnectingZ 5 andS 5, anteriororanteromedialtoinsertionsofJv 5. Marginalserrationmoderatelydeep, obtuse. Opisthonotalsurfacesmooth, onlysomeoval musclescarscanbeseenmedialtoZ 1 – 3. Posterodorsalcavitiesuniform, well-sclerotized, saddlelike, withundulateinnermargin. Lateralpairofcavitiessituatedanteriortocentral pair, belowinsertionsofJ 5 andZ 4, withaxesslightlyconverginganteriorly. Centralpair with axes parallel to that of the body. of female, 25 = epistome of male, 26 = epistome of deutonymph. Ventralside (Fig. 16). Slitbetweenperitrematalshieldsanddorsalshieldsnarrow. PeritrematalshieldstruncateonlevelofS 1, possessingfinereticulationoflongitudinalsutures. Peritremesnearlystraight, withasmalldilationnearstigmata (Fig. 20). Peritrematal setaer 1 short, smoothandbristle-like, r 3 abouttwiceaslongasr 1, finelyserrate. Tritoster- numwithtwoslender, apicallybifurcate, marginallypiloselaciniae, tritosternalbasevaselike. Sternalshield 76 μmlongand 53 μmwideatthelevelofsetaest 2, withfinelycurved posteriormargin, withweaklyconspicuousreticulateornamentation. Sternalsetaesmooth andneedle-like. Glands gv 1 situatedposteromedialtosetaest 3. Genitalshieldtypicalfor thefamily, withafewsutures, genitalsetaesmoothandneedle-like. Glands gv 2 present, withasingleopeningsurroundedbysmalladgenitalsclerites. Ventrianalshieldwide, expandedtoanterolateraldirection, fittingtothemargins, reachingbeyondlevelofposterior edgesofperitrematalshields. Anterioredgeoftheshieldsplitbytwoanterolateral, nearly verticalincisionsexpandingtolevelofsetaeR 3 – 4. Ventrianalshieldwithshort, smooth andneedle-likepreanalandadanalsetae, setaeZv 1 absent. Postanalseta 1.5 – 2 timeslonger thanpreanalandadanalsetae, distallypilose. SetaeZv 3 positionedonlevelofZv 4. Setae Jv 5 moderatelylong, brush-like, pilose. Analvalveswithvestigialeuanalsetae. Glands gv 3 situatedlateraltoadanalsetae. Anteriorsurfaceofventrianalshieldcoveredbytile-like patterntolevelofJv 3 – Zv 3 – Zv 4. Gnathosoma (Fig. 22). Situationofhypostomalandsubcapitularsetaetypicalforthe family. Setae h 1 elongate, apically tapering, smooth. Setae h 2 - 3 shorter than h 1, smooth, h 4 aslongash 2, proximallyserrate. Corniculihorn-like, internalmalaewithapairofbifur- cateanterocentralbranchesandwithserratemargins. Cheliceraemoderatelythick, fixed digitwith 6 teeth, movabledigitwith 4 – 5 teeth. Epistomeof Prozercon - type (Figs 23 – 24). Descriptionofmale (Figs 17, 21). Lengthofidiosoma: 366 μm (355 – 376 μm); width: 296 μm (290 – 306 μm) (n = 5). Chaetotaxy, adenotaxy and sculptural pattern of dorsal, ven- trianalandperitrematalshieldsbasicallysimilartothoseoffemale. Lengthofopisthonotal setaeanddistancesbetweentheirinsertionsasinTable 2. Peritrematalshieldsfusedwith anterolateralpartsofventrianalshield, onlyapairofhorizontalincisionscanbeobserved runningtowardssetaeS 1. Peritremesstraight, withoutanydilation. Sternigenitalshield undivided, bearingfourpairsofsmoothandneedle-likesetae, setaest 5 absent. Sternalse- taest 3 situatedonlevelofanteriorhalfofgenitalopening. Eachcharactersofgnathosoma similartothoseoffemale (Fig. 25), butterminalpartoffixeddigitofcheliceraebifurcate. Descriptionofdeutonymph (Fig. 18). Lengthofidiosoma: 355 μm; width: 290 μm (n = 1). Dorsalchaetotaxy, adenotaxyandappearanceofposterodorsalcavitiesbasicallysimilarto thoseofadults, exceptpositionofsetaeJ 5, whichshiftedposterior, neartheanterolateral edgeofcentraldorsalcavities, thussetaeJ 4 notreachinginsertionsofJ 5. Furthermore podonotal setae z 4 finely serrate. Length of opisthonotal setae and distances between their insertionsasinTable 2. Dorsalornamentationsimilartothatofadults, butlessexpressed. Eachcharactersofgnathosomasimilartothoseofadultfemale (Fig. 26). Etymology. ThespeciesisnamedafterWashington, thestatewhereitwascollected. Differentialdiagnosis. Thetwoknown Macrozercon speciescanbedistinguishedaccordingtoTable 3.	en	Ujvári, Zs. (2013): Review Of The Nearctic Genera Macrozercon Błaszak, 1976 And Microzercon Błaszak, 1976 (Mesostigmata: Zerconidae). Acta Zoologica Academiae Scientiarum Hungaricae 59 (4): 347-389, DOI: 10.5281/zenodo.5736238
03CB878E6525513EFD9BFDFF86F6BC14.taxon	diagnosis	Diagnosis. Idiosomawide, oval. Onlyanarrowslitcanbeobservedbetweenperitrematalshieldsanddorsalshields, ortheseshieldsarefusedwith eachother. Posterolateraltipsofperitrematalshieldsexpandedposteriorly, oftenfusedwithventrianalshield. Peritremesofgeneralsize, expandedtoanteriorhalfofcoxaeIII, straightorslightlybent. Setaer 1 andr 3 shiftedventrallytoperitrematalshields, bothshort, bristle-like, usuallysmooth. Glandsgv 2 present, theiropeningssurroundedbysmalladgenitalsclerites. Ventrianal shieldbearing 19 or 21 setae, setaeZv 1 usuallyabsent. Glandsgv 3 situated anterolateraltoadanalsetae. Setaez 1 absent. Thirdpairofopisthonotalpores associatedwiththeJ-series (inposition gdJ 2 or gdJ 3). Marginofopisthonotum with 7 pairsofR-setae. SetaeS 1 andmost (anterior) R-setaerelativelylong, denselypilose. Posterodorsalcavitiesheterogenousinsizeanddevelopment. Remarks. Redifiningthedisgnosisof Micorzercon accordingtothepreviousobservationsofUJVÁRI (2011 b, c, 2013) onderivativecharactersuseful forgenericclassificationresultedinrecognisingseveraljuniorsysnonimous names as follows.	en	Ujvári, Zs. (2013): Review Of The Nearctic Genera Macrozercon Błaszak, 1976 And Microzercon Błaszak, 1976 (Mesostigmata: Zerconidae). Acta Zoologica Academiae Scientiarum Hungaricae 59 (4): 347-389, DOI: 10.5281/zenodo.5736238
03CB878E65245122FDCDFA5C8606BA88.taxon	description	(Figs 27 – 37)	en	Ujvári, Zs. (2013): Review Of The Nearctic Genera Macrozercon Błaszak, 1976 And Microzercon Błaszak, 1976 (Mesostigmata: Zerconidae). Acta Zoologica Academiae Scientiarum Hungaricae 59 (4): 347-389, DOI: 10.5281/zenodo.5736238
03CB878E65245122FDCDFA5C8606BA88.taxon	description	Materialexamined. USA, California, Mt. Tamalpais, 1000 ma. s. l., pineforest, moss from trees and dry-rotten wood, 12.01.1985, leg. Neiger, M. (HNHM E-Am- 090 – 1 female, 1 male). USA, Oregon, Benton Co., McGlynn Creek Ravine, moss on bank, 23.01.1977, leg. Russel, L. (slideCNCAZ 0394 – 1 female, earlieridentifiedas’ Microzercon sp. ’); USA, Oregon, Benton Co., Marys Peak, log with moss, 05.12.1976, leg. Russel, L. (slide CNCAZ 0613 – 1 female); USA, California, P. O., SanDiego, 3 mi. S. Laguna, pineduffandgrass, 27.03.1961, leg. Lindquist, E. E. (slideCNCAZ 0722 – 1 female); USA, California, MontereyCo., North ForkSanAntonioRiver, 0.7 mi. IndianAgr. Sta., Madroneduff, 29.09.1961, leg. Lindquist, E. E. (slide CNCAZ 0725 – 1 female). Diagnosis of female. The two opisthonotal J setal rows situated on an elevatedcentralridge. Centralandsubmarginalsetaeofpodonotumand opisthonotumsmoothandneedle-like, marginalsetaedenselypilose, brushlike. Glandspo 3 situatedinposition gds 4, lateraltolineconnectings 4 ands 5. GlandsPo 2 inposition gdS 2, onlineS 2 andS 3, Po 3 inposition gdJ 2, posterolateraltoJ 2. Opisthonotumcoveredbyreticulatepattern, withsmallpitsin thecrossingpoints. Lateraldorsalcavitiesweaklydeveloped, centralcavities large, wellsclerotized, withaxesconvergingposteriroly. Posterolateraltipsof peritrematalshieldsfusedwithventrianalshieldonlevelofsetaeR 3 – 4. Descriptionoffemale. Lengthofidiosoma: 348 μm (339 – 360 μm); width: 293 μm (280 – 306 μm) (n = 5). Dorsal side (Fig. 27). Podonotum with 20 pairs of setae, j 1 – 6, z 2 – 6, s 1 – 6, r 2 and r 4 – 5 inserteddorsally, r 1 andr 3 insertedventrally, onperitrematalshields. Setaej 1 – 2, z 3, s 2, r 2, s 3, r 4 – 5 ands 6 moderatelylong, brush-like, denselypilose. Setaes 1 andz 2 shorter, pilose. Other podonotal setae short, smooth and needle-like. Setae s 5 situated between level of z 5 andz 6. Glands gds 1 (po 1) situatedposteriortoinsertionsofs 1; gdj 4 (po 2) situatedonline connecting j 4 and s 4; gds 4 (po 3) lateral to line connecting s 4 and s 5. The whole surface of podonotalshieldcoveredbyscalespossessinglacyposteriormargin, exceptasmallarea oftheposterocentralsurface, whichcoveredbyreticulateornamentation, withsmallpits inthecrossingpoints. Opisthonotumwith 22 pairsofsetae: J 1 – 5, Z 1 – 5 andS 1 – 5, marginalR-serieswith sevenpairsofsetae. SetaeJ 1 – 5, Z 1 – 4 andS 2 – 5 similarinappearance, moderatelylong, smooth, pointed. SetaeJ 1 – 5 constitutenearlyparallellines, eachreachingornearlyreachinginsertionsofthefollowingoneoftheseries. SetaeZ 4 shiftedtowardstheJ-series, situated on line connecting J 4 and S 5. Setae S 2 situated anterior to S 3. Setae Z 5, S 1 and all the R-setaemoderatelylong, brush-like, denselypilose. S 2 – 4 notreachingedgesofopisthonotum, the tips of S 5 expanding beyond the margins of the shield. Length of opisthonotal setaeanddistancesbetweentheirinsertionsasinTable 4. Glands gdZ 1 (Po 1) situatedanteromedialtoinsertionsofZ 1; gdS 2 (Po 2) situatedonlineconnectingS 2 andS 3, nearS 3; gdJ 2 (Po 3) posterolateral to J 2; gdS 5 (Po 4) on line connecting Z 5 and S 5, anteromedial to insertionsofJv 5. Marginalserrationdeep, obtuse. Opisthonotalsurfacecoveredbyreticulate pattern, withsmallpitsinthecrossingpoints. Lateraldorsalcavitiesweaklydeveloped, centralcavitieslarge, wellsclerotized, withaxesconvergingposteriroly. Ventralside (Fig. 28). Peritrematalandventrianalshieldsfusedwithbodymargins. Posterolateraltipsofperitrematalshieldsfusedwithlateralpartsofventrianalshieldon levelofsetaeR 3 – 4, abentincisionbetweenthetwoshieldsrunningtowardsthebody margins. Peritrematalshieldsornamentedbyfinereticulationoflongitudinalsutures. Peri- tremesfinelycurved, withasmalldilationnearstigmata (Figs 30 – 31). Peritrematalsetae r 1 andr 3 short, smoothandbristle-like. Tritosternumwithtwoslender, apicallytrifurcate, marginallypiloselaciniae, tritosternalbaseproximallysubrectangular (Fig. 32). Sternal shield 56 μmlongand 34 μmwideatthelevelofsetaest 2, withstraightposteriormargin, withoutornamentation. Sternalsetaesmoothandneedle-like. Glands gv 1 situatedposteromedialtosetaest 3. Genitalshieldtypicalforthefamily, withoutornamentation, genital setaesmoothandneedle-like. Glands gv 2 present, withasingleopeningontinyadgenital sclerites. Ventrianalshieldwithshort, smoothandneedle-likepreanalsetae, setaeZv 1 absent. Adanal setae and postanal seta 1.5 – 2 times longer than preanal setae, smooth. Setae Jv 5 moderatelylong, brush-like, denselypilose. Analvalveswithvestigialeuanalsetae. of female. Glands gv 3 situatedanterolateraltoadanalsetae. Anteriorsurfaceofventrianalshieldcov- eredbytile-likepatterntolevelofJv 3 – Zv 3 – Zv 4. Gnathosoma (Fig. 33). Situationofhypostomalandsubcapitularsetaetypicalforthe family. Setae h 1 elongate, apically tapering, smooth. Setae h 2 shorter than h 1, h 3 half as longash 2, eachsmooth. Setaeh 4 aslongash 2, proximallyserrate. Corniculihorn-like, internalmalaewithapairofbifurcateanterocentralbranchesandwithserratemargins. Chelicerae (Fig. 34) relativelyslender, fixeddigitwith 6 – 7 teeth, movabledigitwith 4 – 5 teeth. Epistome of Prozercon - type (Figs 35 – 37). Descriptionofmale (Fig. 29). Lengthofidiosoma: 285 μm; width: 231 μm (n = 1). Chaetotaxy, adenotaxyandsculpturalpatternofdorsal, ventrianalandperitrematal shieldsbasicallysimilartothoseoffemale. Lengthofopisthonotalsetaeanddistances betweentheirinsertionsasinTable 4. Peritrematalshieldsfusedwithanterolateralpartsof ventrianalshield, onlyapairofhorizontalincisionscanbeobservedrunningtowardssetaeR 2. Sternigenitalshielddivided, thefirstpairofsternalsetae (st 1) sittingonaseparate pieceofsclerotizedarea, therestofsternalsetaeandgenitalopeningsituatedonthepos- teriorsclerotizedareaofthesternigenitalregion, whichendsonlevelofposteriormargin of coxae IV. Setae st 5 absent. Sternal setae st 3 situated on level of anterior edge of genital opening. Analvalveswithvestigialeuanalsetae. Eachcharactersofgnathosomasimilarto thoseoffemale, butterminalpartoffixeddigitofcheliceraebifurcate.	en	Ujvári, Zs. (2013): Review Of The Nearctic Genera Macrozercon Błaszak, 1976 And Microzercon Błaszak, 1976 (Mesostigmata: Zerconidae). Acta Zoologica Academiae Scientiarum Hungaricae 59 (4): 347-389, DOI: 10.5281/zenodo.5736238
03CB878E65385121FE2AFA4D80A8BD88.taxon	description	est, HiddenCave. Diagnosis of female. Setae j 1 – 3, z 2 and s 1 smooth and needle-like, other centralandsubmarginalsetaeofpodonotumbarbedorpilose. Opisthonotal J-setae, Z 1 – 4 andS 2 – 5 denselypilose, pointed. Opisthomarginalsetaebrushlike, denselypilose. GlandsPo 2 inposition gdS 2, inthecentreofthetriangle Z 2 – S 2 – S 3, Po 3 inposition gdJ 2, situatedposterolateraltoJ 2. Wholesurfaceof podonotalshieldcoveredbyscalespossessinglacyposteriormargin. Surface ofopisthonotumcoveredbysmallalveolarpits. Posterodorsalcavitiesuni- from, saddle-like, withundulateinnermargin. PosterolateraltipsofperitrematalshieldsendfreelyonlevelofsetaeR 5. Remarks. Diagnosisofthespeciesisbasedonthedescriptionandfigures givenbyBŁaSzak etal. (1995).	en	Ujvári, Zs. (2013): Review Of The Nearctic Genera Macrozercon Błaszak, 1976 And Microzercon Błaszak, 1976 (Mesostigmata: Zerconidae). Acta Zoologica Academiae Scientiarum Hungaricae 59 (4): 347-389, DOI: 10.5281/zenodo.5736238
03CB878E653B5124FE1EFD4F8611BD62.taxon	description	(Figs 38 – 48) Bakerasopiparus BŁaSzak, 1984: 588. Typelocalities. USA, Virgnia, GraysonCounty, WhitetopMt., 4000 ft. a. s. l. USA, West Virginia, MercerCounty, CampCreek, St. Forest. Materialexamined. USA, Tennessee, Cumberlandcounty, 07.07.1956, leg. Bohnsack, K (HNHM E-Am- 007 – 3 females, 6 males, 1 deutonymph); USA, North Carolina, Burke Co., LinvilleFallsgorgearea, BlueRidgePkwy. 975 ma. s. l., frommixeddeciduous & white pinelitter, 11.08.1986, leg. Lindquist, E. E. (slideCNCAZ 0547 – 1 female); USA, WestVir- ginia, PocahontasCo., HillsCreekFallsarea, 27 kmE. Richwood, 915 ma. s. l., ex. deciduous litter, rottenwood, moss & substrate, 03.08.1986, leg. Lindquist, E. E. (slideCNCAZ 0636 – 1 male; slide CNCAZ 0637 – 1 female; slide CNCAZ 0638 – 1 female; slide CNCAZ 0640 – 1 female; slide CNCAZ 0657 – 1 female; slide CNCAZ 0660 – 1 female; slide CNCAZ 0708 – 1 female; slide CNCAZ 0709 – 1 female); USA, Alabama, De Kalb Co., De Soto State Park, Little River Canyon, ex. Rhododendron litter on NW facing bank, 28.09.1992, leg. Behan, V. (slide CNCAZ 0781 – 1 female). Diagnosisoffemale. Dorsalsetaepiloseexceptj 4 – 5. EachJ-setareaching basesofthefollowingoneoftheseries. Eachmarginalsetasimilarinappear- ance, denselypilose, brush-like. GlandsPo 2 situatedinposition gdS 2, online connectingS 2 andS 3, nearS 3, Po 3 situatedinposition gdJ 2, posterolateralto J 2. Anteriorsurfaceofpodonotalshieldcoveredbyscalespossessinglacypos- teriormargin. Opisthonotalsurfacesmooth. Posterodorsalcavitiesuniform, round, weaklydeveloped. Posterolateraltipsofperitrematalshieldsreaching levelofR 3, freeorfusedwithlateralpartsofventrianalshield. Descriptionoffemale. Lengthofidiosoma: 382 μm (360 – 398 μm); width: 327 μm (296 – 349 μm) (n = 10). Dorsal side (Fig. 38). Podonotum with 20 pairs of setae, j 1 – 6, z 2 – 6, s 1 – 6, r 2 and r 4 – 5 inserteddorsally, r 1 andr 3 insertedventrally, onperitrematalshields. Dorsalpodonotal setadenselypilose, exceptj 4 – 5 whichsmoothandneedle-like. Marginalpodonotalsetae brush-like, submarginalandcentralsetaepointed. Setaes 5 situatedbetweenlevelofz 5 and z 6. Glands gds 1 (po 1) situated on line connecting j 3 and z 2; gdj 4 (po 2) situated on line connecting j 5 and z 4, near z 4; gds 4 (po 3) slightly medial to line connecting s 4 and s 5. The surfaceinfrontofthelineconnectingsetaes 5 coveredbyscalespossessinglacyposterior margin, theposteriormostpodonotalsurfacesmooth. Opisthonotumwith 22 pairsofsetae: J 1 – 5, Z 1 – 5 andS 1 – 5, marginalR-serieswith sevenpairsofsetae. SetaeJ 1 – 5, Z 1 – 4 andS 2 – 5 similarinappearance, relativelylong, point- ed, denselypilose (Fig. 42). SetaeJ 1 – 5 andZ 1 – 4 constitutenearlyparallellines. SetaeZ 4 situated on line connecting Z 3 and S 5. Setae S 2 situated anterior to S 3. Setae S 2 – 4 not reaching edgesofopisthonotum, thetipsofS 5 expandingbeyondmarginsoftheshield. SetaeZ 5, S 1 andR 1 – 7 denselypilose, apicallybroadening, brush-like. R 7 significantlyshorterthan therestofR-setae. Lengthofopisthonotalsetaeanddistancesbetweentheirinsertionsas inTable 5. Glands gdZ 1 (Po 1) situatedanteromedialtoinsertionsofZ 1; gdS 2 (Po 2) situated on line connecting S 2 and S 3, near S 3; gdJ 2 (Po 3) posterolateral to J 2; gdS 5 (Po 4) on line connectingZ 5 andS 5, anteromedialtoinsertionsofJv 5. Marginalserrationdeepandobtuse. Opisthonotalsurfacesmooth. Posterodorsalcavitiesuniform, round, weaklydeveloped. Lateralpairofcavitiessituatedanteriortocentralpair, betweeninsertionsofJ 5 andZ 4. Ventralside (Fig. 39). Theslitbetweenperitrematalshieldsandbodymarginsnarrow. Posterolateraltipsofperitrematalshieldsfreeorfusedwithlateralpartsofventrianalshield onlevelofsetaeR 3. Peritrematalshieldsornamentedbyfinereticulationoflongitudinal lines. Peritremesfinelycurved, with 1 – 3 smalldilations. Peritrematalsetaer 1 andr 3 short, smoothandneedle-like. Tritosternumwithtwoslender, apicallybifurcate, marginallypilose laciniae, tritosternalbasevase-like. Sternalshield 51 μmlongand 37 μmwideatthelevelof setaest 2, withnearlystraightposteriormargin, withreticulateornamentation. Sternalsetae smoothandneedle-like. Glands gv 1 situatedanteromedialtosetaest 3. Genitalshieldtypi- calforthefamily, withoutornamentation, genitalsetaesmoothandneedle-like. Glands gv 2 present, withsingleordoubleopeningssurroundedbysmalladgenitalsclerites. Ventrianal shieldwithsmoothandneedle-likesetae, setaeZv 1 absent. Adanalsetae, Jv 4 andpostanal seta 2 timeslongerthanotherpreanalsetae. SetaeJv 5 moderatelylong, brush-like, densely pilose. Analvalveswithvestigialeuanalsetae. Glands gv 3 situatedanterolateraltoadanal setae. Anteriorsurfaceofventrianalshieldcoveredbytile-likepatterntolevelofJv 3 - Zv 4. Gnathosoma (Fig. 46). Situationofhypostomalandsubcapitularsetaetypicalforthe family. Setae h 1 elongate, apically tapering, smooth. Setae h 2 shorter than h 1, h 3 shorter than h 2, each smooth. Setae h 4 slightly longer than h 2, proximally serrate. Corniculi hornlike, internalmalaewithapairofbifurcateanterocentralbranchesandwithserratemar- gins. Cheliceraerelativelyslender, fixeddigitwith 6 teeth, movabledigitwith 4 teeth. Epistome of Prozercon - type (Figs 47 – 48). Descriptionofmale (Fig. 40). Lengthofidiosoma: 312 μm (296 – 333 μm); width: 265 μm (247 – 296 μm) (n = 7). Chaetotaxy, adenotaxy and sculptural pattern of dorsal, ventri- analandperitrematalshieldsbasicallysimilartothoseoffemale, exceptshapeofj 3 which smoothinmale. Lengthofopisthonotalsetaeanddistancesbetweentheirinsertionsas inTable 5. Peritrematalshieldsfusedwithanterolateralpartsofventrianalshield, onlya pairofhorizontalincisionscanbeobservedrunningtowardssetaeR 1. Sternigenitalshield divided, thefirstpairofsternalsetae (st 1) sittingonaseparatepieceofsclerotizedarea, therestofsternalsetaeandgenitalopeningsituatedontheposteriorsclerotizedareaofthe sternigenitalregion, whichendsonlevelofposteriormarginofcoxaeIV. Setaest 5 present. Sternalsetaest 3 situatedonlevelofcentralpartofgenitalopening. Analvalveswithves- tigialeuanalsetae. Eachcharactersofgnathosomasimilartothoseoffemale, butterminal partoffixeddigitofcheliceraebifurcate. Descriptionofdeutonymph (Fig. 41). Lengthofidiosoma: 311 μm; width: 258 μm (n = 1). Dorsalchaetotaxy, adenotaxyandappearanceofposterodorsalcavitiesbasicallysimilarto thoseofadults, exceptshapeofcentralandsubmarginalsetaeofdorsalshields, whichless pilosethanthoseofadults, setaes 1, j 3 – 5 andZ 3 – 4 appearstobesmoothorbarelypilose. LengthofopisthonotalsetaeanddistancesbetweentheirinsertionsasinTable 5. Dorsal ornamentationsimilartothatofadults, butlessexpressed. Eachcharactersofgnathosoma similartothoseofadultfemale. Remarks. Similarlytothatof Macrozerconpraecipuus, somedifferencescan beobservedbetweenthespecimensoftheCNCandHNHMcollections. The ventral view of gnathosoma, female, 47 – 48 = epistomes of female. CNCspecimenscorrespondwiththetypespecimensdescribedbyBŁaSzak (1984), theyarerelativelylarge (376 – 398 μm), posterolateraltipsoftheirperi- trematalshieldsendfreely, andtheirperitremespossessextratubercules (Figs 44 – 45). Incontrast, theHNHMspecimensaresmaller (360 – 370 μm), posterolateraltipsoftheirperitrematalshieldsarefusedwiththeventrianalshield, andtheirperitremeshaveonlyasingletubercule (Fig. 43).	en	Ujvári, Zs. (2013): Review Of The Nearctic Genera Macrozercon Błaszak, 1976 And Microzercon Błaszak, 1976 (Mesostigmata: Zerconidae). Acta Zoologica Academiae Scientiarum Hungaricae 59 (4): 347-389, DOI: 10.5281/zenodo.5736238
03CB878E653E5129FD9AFD35807FBA79.taxon	description	(Figs 49 – 54) Type material. Holotype: female – USA, Alaska, Semidi Island, 25.08.1980, leg. Hatch, M. A. (slideCNCAZ 0378). Paratypes: localityanddateasfortheholotype (slideCNCAZ 0376 – 1 male; slide CNCAZ 0377 – 1 male); USA, Alaska, Aleutians, Amchitka Island, 09.1976 (slideCNCAZ 0365 – 1 maleidentifiedearlieras‘ Microzerconcalifornicus ’; slideCNCAZ 0366 – 1 maleidentifiedearlieras‘ Microzerconcalifornicus ’); USA, Alaska, BuldirIsland, Elev. 10 m. Slope 25 o. Aspect 40 o A 2, Calamagrostisutkaensis, Carex, BaseQ, Hillsidefacingalluvialvalley, 03.09.1976 (slideCNCAZ 0367 – 1 femaleidentifiedearlieras‘ Microzerconcalifornicus ’; slide CNCAZ 0368 – 1 maleidentifiedearlieras‘ Microzerconcalifornicus ’). Diagnosis of female. Setae j 2 and z 3 smooth and needle-like, as well as othercentralandsubmarginalsetaeofpodonotum. Eachmarginalsetasimi- larinappearance, denselypilose, brush-like. OpisthonotalJ-setaefinelyser- rateproximally, pointed, othercentralandsubmarginalsetaeofopisthonotum smooth, needle-like. Glands Po 2 in position gdS 2, on line S 2 and S 3, Po 3 absent. Anteriorsurfaceofpodonotalshieldcoveredbyscalespossessinglacy posteriormargin. Surfaceofopisthonotumsmooth. Posterodorsalcavities unifrom, weaklydeveloped. Posterolateraltipsofperitrematalshieldsfused withventrianalshieldonlevelofsetaeR 2. Descriptionoffemale. Lengthofidiosoma: 330 μm (328 – 333 μm); width: 315 μm (312 – 317 μm) (n = 2). Dorsal side (Fig. 49). Podonotum with 20 pairs of setae, j 1 – 6, z 2 – 6, s 1 – 6, r 2 and r 4 – 5 inserteddorsally, r 1 andr 3 insertedventrally, onperitrematalshields. Setaej 1, s 2, r 2, s 3, r 4 – 5 ands 6 moderatelylong, brush-like, denselypilose. Otherpodonotalsetaeshort, smooth and needle-like. Setae s 5 situated on level of z 5. Glands gds 1 (po 1) situated medial toinsertionsofs 1; gdj 4 (po 2) situatedabovelineconnectingj 4 andz 4, nearz 4; gds 4 (po 3) onlineconnectings 4 ands 5, nears 5. Anteriorsurfaceofpodonotalshieldcoveredby scalespossessinglacyposteriormargin, asmallareaoftheposterocentralsurfacewithout ornamentation. Opisthonotumwith 22 pairsofsetae: J 1 – 5, Z 1 – 5 andS 1 – 5, marginalR-serieswith sevenpairsofsetae. SetaeJ 1 – 5 finelyserrateproximally, pointed. SetaeJ 2 reachinginser- tionsofJ 3, otherJ-setaenotreachingbasesofthefollowingoneoftheseries. SetaeJ 5 situatedonlevelofcentraldorsalcavities. SetaeZ 1 – 4 andS 2 – 5 similarinappearance, smooth, pointed, needle-like. SetaeJ 1 – 5 andZ 1 – 4 constitutenearlyparallellines. SetaeZ 4 situated on line connecting Z 3 and S 5. Setae S 2 situated anterior to S 3. Setae Z 5, S 1 and R 1 – 6 brushlike, denselypilose, R 7 somewhatshorterthanprevioussetae, bent, pointed, pilose. None ofS-setaereachingbeyondmarginsofopisthonotum. Lengthofopisthonotalsetaeand distancesbetweentheirinsertionsasinTable 6. Glands gdZ 1 (Po 1) situatedlateraltoinser- tions of Z 1; gdS 2 (Po 2) situated on line connecting S 2 and S 3, near S 3; glands Po 3 absent; gdS 5 (Po 4) onlineconnectingJv 5 andS 5, equidistantly. Marginalserrationdeep, obtuse. Opisthonotalsurfacewithoutornamentation. Posterodorsalcavitiesuniform, multangular, weaklydeveloped. Lateralpairofcavitiessituatedanteriortocentralpair, betweeninser- tions of J 5 and Z 4. Ventralside (Fig. 50). Peritrematalandventrianalshieldsfusedwithbodymargins. Posterolateraltipsofperitrematalshieldsfusedwithlateralpartsofventrianalshieldon levelofsetaeR 2. Peritrematalshieldsornamentedbyfinereticulationoflongitudinalsutures. Peritremesfinelycurved, withasmalldilationnearstigmata. Peritrematalsetaer 1 short, smoothandneedle-like, setaer 3 short, finelypilose, pointed. Tritosternumwithtwo slender, apicallybifurcate, marginallypiloselaciniae, tritosternalbasevase-like. Sternal shield 48 μmlongand 43 μmwideatthelevelofsetaest 2, withslightlyarcuateposteriormargin, withinconspicuousreticulate ornamentation. Sternalsetaesmoothand needle-like. Glands gv 1 situatedmedial tosetaest 3. Genitalshieldtypicalforthe family, withafewsutures, genitalsetae smooth and needle-like. Glands gv 2 present, withdoubleopeningssurroundedbysmalladgenitalsclerites. Ventrianal shieldwithsmoothandneedle-likesetae, setaeZv 1 absent. Adanalsetae, Jv 4 and postanalseta 1.5 – 2 timeslongerthanother preanalsetae. SetaeJv 5 moderatelylong, brush-like, denselypilose. Analvalves withvestigialeuanalsetae. Glands gv 3 situatedlateralorslightlyposterolateral toadanalsetae. Anteriorsurfaceofventri- analshieldcoveredbytile-likepatternto levelofJv 3 – Zv 4. Gnathosoma. Situationofhypos- tomalandsubcapitularsetaetypicalfor the family. Setae h 1 elongate, apically tapering, smooth. Setaeh 2 shorterthanh 1, h 3 shorter than h 2, each smooth. Setae h 4 slightlylongerthanh 2, proximallyserrate. Corniculihorn-like, internalmalaewitha pairofbifurcateanterocentralbranches andwithserratemargins. Cheliceraerela- tivelyslender, fixeddigitwith 5 – 6 teeth, movabledigitwith 4 – 5 teeth. Epistomeof Prozercon - type. Descriptionofmale (Fig. 51). Length of idiosoma: 265 μm (258 – 274 μm); width: Figs 52 – 54. Microzercon alaskaensis sp. n. male: 243 μm (231 – 269 μm) (n = 5). Chaetotaxy, 52 – 53 = chelicerae, 54 = epistome. adenotaxyandsculpturalpatternofdorsal, ventrianalandperitrematalshieldssimilarto thoseoffemale. Lengthofopisthonotalsetaeanddistancesbetweentheirinsertionsasin Table 6. Peritrematalshieldsfusedwithanterolateralpartsofventrianalshield, onlyapair ofhorizontalincisionscanbeobservedrunningtowardssetaeR 2. Sternigenitalshielddi- vided, theanteriorpartbearingsetaest 1, thecentralpartpossessthegenitalopeningand generally has three pairs of smooth and needle-like setae, setae st 4 may be absent. A small, subtriangularposteriorsternigenitalscleritesituatedbetweencoxaeIV, withoutsetae, setaest 5 alwaysabsent. Sternalsetaest 3 situatedonlevelofcentralpartofgenitalopening. Glands gv 2 withasingleopening, surroundedbytinyadgenitalsclerites. Eachcharacters ofgnathosomasimilartothoseoffemale (Fig. 54), butterminalpartoffixeddigitofcheli- ceraebifurcate (Figs 52 – 53). Etymology. The new species is named after Alaska, the state where it was collected. Remarks. Theknown Microzercon speciescanbedistinguishedaccording tokeypresentedbelow.	en	Ujvári, Zs. (2013): Review Of The Nearctic Genera Macrozercon Błaszak, 1976 And Microzercon Błaszak, 1976 (Mesostigmata: Zerconidae). Acta Zoologica Academiae Scientiarum Hungaricae 59 (4): 347-389, DOI: 10.5281/zenodo.5736238
03CB878E6533512EFDA2FA3E808FBB3C.taxon	description	(Figs 55 – 61) Typematerial. Holotype: female – USA, Washington, SkamaniaCo., WindRiver Crane Canopy Res., 45 ° 49 ’ 14 ” N 121 ° 57 ’ W, ex. Douglas fir, lichens, 29.09.2000, leg. Behan, V. & Eamer, B. (slideCNCAZ 0717); Paratype: Canada, BritishColumbia, VancouverIsland, Mt. Maquilla, 1200 ma. s. l., litterbagswith Abiesamabilis needlesongroundbelow (A. amabilis), 22.06 – 22.08.1998, leg. Fagan (slideCNCAZ 0397 – 1 femaleidentifiedearlieras ‘ Microzercon sp. ’). Diagnosis of female. Setae j 2 and z 3 smooth and needle-like, as well as othercentralandsubmarginalsetaeofpodonotum, exceptz 6 ands 5 which moderatelylong, pilose. OpisthonotalJ-setae, Z 1 – 4 andS 2 – 5 pointed, densely coveredbyshortpili. Marginalsetaedenselypilose, brush-like. GlandsPo 2 in position gdS 2, belowlineconnectingS 2 andS 3, Po 3 inposition gdJ 3, situated posterolateraltoJ 3. Anteriorsurfaceofpodonotalshieldcoveredbyscales possessingspinyandlacyposteriormargin. Surfaceofopisthonotumsmooth, withafewtinypitsbetweentheJ-andZ-series. Lateralposterodorsalcavities weaklydeveloped, centralcavitiesinconspicuous. Posterolateraltipsofperi- trematalshieldsfusedwithventrianalshieldonlevelofsetaeR 3. Descriptionoffemale. Lengthofidiosoma: 338 – 345 μm (342 μm); width: 295 – 300 μm (298 μm) (n = 2). Dorsal side (Fig. 55). Podonotum with 20 pairs of setae, j 1 – 6, z 2 – 6, s 1 – 6, r 2 and r 4 – 5 inserteddorsally, r 1 andr 3 insertedventrally, onperitrematalshields. Setaej 1, s 2, r 2, s 3, r 4 – 5 ands 6 moderatelylong, brush-like, denselypilose. Setaej 2 – 6, z 2 – 5, s 1 ands 4 smooth andneedle-like. Setaez 6 ands 5 moderatelylong, pointed, denselycoveredbyshortpili. Setaes 5 situatednearlevelofz 5. Glands gds 1 (po 1) situatedposteriortoinsertionsofs 1, medial to setae z 2; gdj 4 (po 2) situated below line connecting j 4 and z 4, near z 4; gds 4 (po 3) lateraltolineconnectings 4 ands 5. Centralsurfaceofpodonotalshieldcoveredbyscales possessingspinyposteriormargin, anterolateralsurfacewithscalespossessinglacyposteriormargin, theposteriorareawithoutornamentation. Opisthonotumwith 22 pairsofsetae: J 1 – 5, Z 1 – 5 andS 1 – 5, marginalR-serieswith seven pairs of setae. Setae J 1 – 5, Z 1 – 4 and S 2 – 5 similar in appearance, moderately long, pointed, denselycoveredbyshortpili. J 1 – 4, Z 1 – 3 andS 2 reachinginsertionsofthefollowingsetaeoftheseries. SetaeJ 1 – 5 andZ 1 – 4 constitutenearlyparallellines. SetaeZ 4 situated on line connecting Z 3 and S 5. Setae S 2 situated anteromedial to S 3. Setae Z 5, S 1 and R 1 – 6 brush-like, denselypilose, R 7 somewhatshorterthanprevioussetae, bent, pointed, pilose. SetaeS 2 – 4 notreachingbeyondmarginsofopisthonotum, thetipsofsetaeJ 5 and S 5 expandingbeyondmarginsofidiosoma. Lengthofopisthonotalsetaeanddistances betweentheirinsertionsasinTable 7. Glands gdZ 1 (Po 1) situatedanteromedialtoinser- tions of Z 1; gdS 2 (Po 2) situated below line connecting S 2 and S 3; gdJ 3 (Po 3) posterolateral to insertionsofJ 3; gdS 5 (Po 4) onlineconnectingJv 5 andS 5, equidistantly. Marginalserration deep, obtuse. TheareaofmusclescarsbetweentheJ-andZ-seriescoveredbyseveraltiny pits, therestofopisthonotumwithoutsculpturalpattern. Lateralposterodorsalcavities multangular, weaklydeveloped, situatedbetweeninsertionsofJ 5 andS 5. Centralcavities inconspicuous. Ventralside (Fig. 56). Peritrematalandventrianalshieldsfusedwithbodymargins. Posterolateraltipsofperitrematalshieldsfusedwithlateralpartsofventrianalshieldon levelofsetaeR 3. Patternofperitrematalshieldsinconspicuous. Peritremesfinelycurved, withasmalldilationnearstigmata. Peritrematalsetaer 1 andr 3 short, smoothandbristlelike. Tritosternumwithtwoslender, apicallybifurcate, marginallypiloselaciniae, tritos- ternalbasevase-like (Fig. 57). Sternalshield 53 μmlongand 40 μmwideatthelevelof setaest 2, withslightlyarcuateposteriormargin, withreticulateornamentation. Sternal setaesmoothandneedle-like. Glands gv 1 situatedmedialtosetaest 3. Genitalshieldtypi- calforthefamily, withafewsutures, genitalsetaesmoothandneedle-like. Glands gv 2 present, withasingleopeningsurroundedbytinyadgenitalsclerites. Ventrianalshield withsmoothandneedle-likesetae, setaeZv 1 absent. Adanalsetae, Jv 4 andpostanalseta 1.5 – 2 timeslongerthanotherpreanalsetae. SetaeJv 5 moderatelylong, brush-like, densely pilose. Analvalveswithvestigialeuanalsetae. Glands gv 3 situatedlateraltoadanalsetae. Anteriorsurfaceofventrianalshieldcoveredbytile-likepatterntolevelofJv 3 – Jv 4. Gnathosoma (Fig. 58). Situationofhypostomalandsubcapitularsetaetypicalforthe family. Setae h 1 elongate, smooth. Setae h 2 - 3 shorter than h 1, smooth, h 4 longer than previ- oussetae, serrate. Corniculihorn-like, internalmalaewithapairofbifurcateanterocentral branchesandwithserratemargins. Chelicerae (Fig. 59) relativelyslender, fixeddigitwith 6 teeth, movabledigitwith 4 – 5 teeth. Epistomeof Prozercon - type (Figs 60 – 61). Etymology. The new species is dedicated to the memory of Luise Mahunka-Papp, wifeofProf. Dr. SándorMahunka.	en	Ujvári, Zs. (2013): Review Of The Nearctic Genera Macrozercon Błaszak, 1976 And Microzercon Błaszak, 1976 (Mesostigmata: Zerconidae). Acta Zoologica Academiae Scientiarum Hungaricae 59 (4): 347-389, DOI: 10.5281/zenodo.5736238
03CB878E65345113FD92FBFB8165B9CE.taxon	description	(Figs 62 – 76) Typematerial. Holotype: female – Canada, BritishColumbia, VancouverIsland, Comoxglacier, dryhemlock, spruceforest, ex. moss, litter, 27.08.1983, leg. Fjellberg, A. (slide CNCAZ 0408 – identifiedearlieras‘ Microzercon sp. ’). Paratypes: localityanddateasfor theholotype (slideCNCAZ 0409 – 1 maleidentifiedearlieras‘ Microzercon sp. ’; slideCN- CAZ 0410 – 1 maleidentifiedearlieras‘ Microzercon sp. ’); Canada, BritishColumbia, VancouverIsland, Mt. Cain, 1000 ma. s. l., litterbagswith Abiesamabilis needlesongroundbelow (A. amabilis), 22.05.1997 - 22.05.1998, leg. Fagan (slide CNCAZ 0404 – 1 female identified earlieras‘ Microzercon sp. ’); Canada, BritishColumbia, VancouverIsland, Mt. Cain, 1200 m a. s. l., litter bags with Abies amabilis needles on ground below (A. amabilis), 22.05.1997 - 22.05.1998, leg. Fagan (slideCNCAZ 0400 – 1 femaleidentifiedearlieras‘ Microzercon sp. ’); Canada, BritishColumbia, VancouverIsland, Mt. Cain, 800 ma. s. l., litterbagswith Abies amabilis needles on ground below (A. amabilis), 22.05. – 22.09.1997, leg. Fagan (slide CN- CAZ 0396 – 1 maleidentifiedearlieras‘ Microzercon sp. ’; slideCNCAZ 0398 – 1 femaleiden- tifiedearlieras‘ Microzercon sp. ’; slideCNCAZ 0399 – 1 maleidentifiedearlieras‘ Microzercon sp. ’; slideCNCAZ 0402 – 1 femaleidentifiedearlieras‘ Microzercon sp. ’); Canada, BritishColumbia, VancouverIsland, Mt. Cain, 800 ma. s. l., litterbagswith Abiesamabilis needles on ground below (A. amabilis), 22.05. - 22.09.1998, leg. Fagan (slide CNCAZ 0403 – 1 femaleidentifiedearlieras‘ Microzercon sp. ’); Canada, BritishColumbia, VancouverIsland, Mt. Cain, 800 m a. s. l., litter bags with Abies amabilis needles on ground below (A. amabilis), 22.05. – 22.08.1998, leg. Fagan (slideCNCAZ 0405 – 1 maleidentifiedearlieras‘ Microzercon sp. ’; slideCNCAZ 0407 – 1 maleidentifiedearlieras‘ Microzercon sp. ’); Canada, BritishColumbia, VancouverIsland, Mt. Cain, 800 ma. s. l., litterbagswith Abiesamabilis needleson ground below (A. amabilis), 22.05.1997 - 22.05.1998, leg. Fagan (slide CNCAZ 0406 – 1 male identifiedearlieras‘ Microzercon sp. ’); Canada, BritishColumbia, VancouverIsland, Mt. Maquilla, 1200 ma. s. l., litterbagswith Abiesamabilis needlesongroundbelow (A. amabilis), 22.06 – 22.08.1998, leg. Fagan (slideCNCAZ 0401 – 1 maleidentifiedearlieras‘ Microzercon sp. ’). Diagnosis of female. Setae j 2 smooth and needle-like, as well as other centralandsubmarginalsetaeofpodonotum. OpisthonotalJ-setae, Z 1 – 4 and S 2 – 4 smooth, pointed. SetaeS 5 denselypilose, feathered. SetaeJ 5 situated beyondlevelofcentralposterodorsalcavities. Anterioropisthomarginalsetae (S 1 andR 1 – 4) feathered, posterioropisthomarginalsetae (R 5 – 7) smooth, pointed. GlandsPo 2 inposition gdS 2, onlineZ 1 andS 2, Po 3 inposition gdJ 3, situatedposterolateraltoJ 3. Wholesurfaceofpodonotalshieldcoveredby scalespossessinglacyposteriormargin. Surfaceofopisthonotumreticulate, withpitsofmoderatesizeinthecrossingpoints. Posterodorsalcavitiesuni- from, saddle-like, withundulateinnermargin. PosterolateraltipsofperitrematalshieldsfusedwithventrianalshieldonlevelofsetaeR 3. Descriptionoffemale. Lengthofidiosoma: 410 μm (392 – 425 μm); width: 346 μm (339 – 350 μm) (n = 6). Dorsal side (Fig. 62). Podonotum with 20 pairs of setae, j 1 – 6, z 2 – 6, s 1 – 6, r 2 and r 4 – 5 inserteddorsally, r 1 andr 3 insertedventrally, onperitrematalshields. Setaej 2 – 6, s 1, z 2, z 4 – 6 and s 4 – 5 smooth and needle-like. Setae s 2 and r 3 short, barbed. Setae j 1, z 3, s 3, r 4 – 5 and r 6 moderately long, feathered. Setae s 5 situated on level of z 6. Glands gds 1 (po 1) situatedmedialtoinsertionsofs 1; gdj 4 (po 2) situatedonlineconnectingj 4 andz 4; gds 4 (po 3) onlineconnectings 4 andz 6, nears 4. Wholesurfaceofpodonotalshieldcoveredbyscales possessinglacyposteriormargin. Opisthonotumwith 22 pairsofsetae: J 1 – 5, Z 1 – 5 andS 1 – 5, marginalR-serieswith sevenpairsofsetae. SetaeJ 1 – 5, Z 1 – 4 andS 2 – 4 similarinappearance, moderatelylong, smooth, pointed. SetaeJ 4 reachingbeyondinsertionsofJ 5. SetaeJ 5 situatedbeyondlevel ofcentralposterodorsalcavities. SetaeJ 1 – 5 andZ 1 – 4 constituteparallellines. SetaeZ 4 situated on, or somewhat medial to line connecting Z 3 and S 5. Setae S 2 situated anterior to S 3. Setae Z 5, S 1, S 5 and R 1 – 4 feathered, densely pilose. Setae R 5 – 7 at most half as long as anteriorR-setae, smooth, pointed. SetaeS 2 – 4 notreachingbeyondmarginsofopisthonotum, S 5 expandingbeyondthemargins. Lengthofopisthonotalsetaeanddistancesbetween theirinsertionsasinTable 8. Glands gdZ 1 (Po 1) situatedanteromedialtoinsertionsofZ 1; gdS 2 (Po 2) situated on line connecting Z 1 and S 2, near S 3; glands gdJ 3 (Po 3) posterolateral toJ 3; gdS 5 (Po 4) onlineconnectingZ 5 andS 5, anteromedialtoinsertionsofJv 5. Marginal serrationdeep, obtuse. Opisthonotalsurfacereticulate, withpitsofmoderatesizeinthe crossingpoints. Posterodorsalcavitiesuniform, well-sclerotized, saddle-like, withundulateinnermargin. Lateralpairofcavitiessituatedonlevelofcentralpair, betweeninser- tionsofJ 5 andZ 4, withaxesslightlyconverginganteriorly. Centralpairwithaxesparallel to that of the body. Ventralside (Fig. 63). Peritrematalandventrianalshieldsfusedwithbodymargins. Posterolateraltipsofperitrematalshieldsfusedwithlateralpartsofventrianalshieldon levelofsetaeR 3. Peritrematalshieldsornamentedbyreticulationoflongitudinalsutures. Peritremesbent, withasmalldilationnearstigmata. Peritrematalsetaer 1 andr 3 short, smoothandbristle-like. Tritosternumwithtwoslender, apicallybifurcateortrifurcate, marginallypiloselaciniae, tritosternalbaseproximallysubrectangular (Figs 65 – 66). Sternal shield 61 μmlongand 52 μmwideatthelevelofsetaest 2, withstraightposteriormargin anddistinct, reticulateornamentation. Sternalsetaesmoothandneedle-like. Glands gv 1 situatedmedialtosetaest 3. Genitalshieldtypicalforthefamily, withirregularornamentationofafewsutures, genitalsetaesmoothandneedle-like. Glands gv 2 present, with doubleopeningssurroundedbysmalladgenitalsclerites. Ventrianalshieldwithsmooth setae, setaeZv 1 absent. Adanalsetae, Jv 3 – 4 andpostanalseta 1.5 – 2 timeslongerthanother preanalsetae. SetaeJv 5 moderatelylong, denselypilose, feathered. Analvalveswithves- tigialeuanalsetae. Glands gv 3 situatedanterolateraltoadanalsetae. Anteriorsurfaceof ventrianalshieldcoveredbytile-likepatterntolevelofadanalsetaeandJv 4. Gnathosoma (Fig. 67). Situationofhypostomalandsubcapitularsetaetypicalforthe family. Setae h 1 elongate, apically tapering, smooth. Setae h 2 somewhat shorter than h 1, h 3 half as long as h 2, each smooth. Setae h 4 slightly longer than h 2, proximally serrate. Corniculihorn-like, internalmalaewithapairofbifurcateanterocentralbranchesandwith serratemargins. Chelicerae (Figs 68 – 69) relativelyslender, fixeddigitwith 6 – 7 teeth, mov- able digit with 4 – 5 teeth. Epistome of Prozercon - type (Fig 71 – 73). Descriptionofmale (Fig. 64). Lengthofidiosoma: 350 μm (322 – 366 μm); width: 290 μm (285 – 296 μm) (n = 8). Chaetotaxy, adenotaxy and sculptural pattern of dorsal, ven- trianalandperitrematalshieldssimilartothoseoffemale. Lengthofopisthonotalsetae anddistancesbetweentheirinsertionsasinTable 8. Peritrematalshieldsfusedwithante- rolateralpartsofventrianalshield, onlyapairofbentincisionscanbeobservedrunning towardssetaeR 2. Sternigenitalshieldundivided, bearingfourpairsofsmoothandneedlelikesetae, setaest 5 absent. Sternalsetaest 3 situatedonlevelofanteriorpartofgenital opening. Glands gv 2 withdoubleopenings, surroundedbysmalladgenitalsclerites. A narrowpostgenitalscleritepresentbetweenopeningsofglands gv 2. Eachcharactersof gnathosomasimilartothoseoffemale (Figs 74 – 76), butterminalpartoffixeddigitofcheliceraebifurcate (Fig. 70). Etymology. The new species is dedicated to the memory of Prof. Dr. Sándor Mahunka, Academician, formerheadoftheSystematicZoologyResearchGroupoftheHungarian AcademyofSciences, worldrenownoribatidologist.	en	Ujvári, Zs. (2013): Review Of The Nearctic Genera Macrozercon Błaszak, 1976 And Microzercon Błaszak, 1976 (Mesostigmata: Zerconidae). Acta Zoologica Academiae Scientiarum Hungaricae 59 (4): 347-389, DOI: 10.5281/zenodo.5736238
03CB878E65085110FD7CFE2C8048BA8C.taxon	description	(Figs 77 – 80) Type material. Holotype – USA, Oregon, Benton Co., McGlynn Cr. Ravine, moss on bank, 23.01.1977, leg. Russel, L. (slide CNCAZ 0395 – 1 female). Diagnosisoffemale. Centralandsubmarginalsetaeofpodonotum smooth, includingj 2, setaez 3 elongate, pilose. Eachmarginalsetasimilar inappearance, denselypilose, brush-like. Centralandsubmarginalsetaeof opisthonotumsmooth, needle-like. GlandsPo 2 inposition gdS 2, onlineS 2 and S 3, Po 3 in position gdJ 3, on line connecting J 3 and J 4. Anterior surface of podonotalshieldcoveredbyscalespossessinglacyposteriormargin. Surface ofopisthonotumsmooth. Posterodorsalcavitiesunifrom, weaklydeveloped. Posterolateraltipsofperitrematalshieldsfusedwithventrianalshieldonlev- el of setae R 3. Descriptionoffemale. Lengthofidiosoma: 344 μm; width: 295 μm (n = 1). Dorsal side (Fig. 77). Podonotum with 20 pairs of setae, j 1 – 6, z 2 – 6, s 1 – 6, r 2 and r 4 – 5 inserteddorsally, r 1 andr 3 insertedventrally, onperitrematalshields. Setaez 3, s 2, r 2, s 3, r 4 – 5 ands 6 moderatelylong, brush-like, denselypilose. Setaej 1 shorterthanprevioussetae, barbed. Otherpodonotalsetaeshort, smoothandneedle-like. Setaes 5 situatedonlevel Figs 65 – 76. Microzercon mahunkai sp. n.: 65 – 66 = tritosternums of female, 67 = gnathosoma of female, 68 – 69 = chelicerae of female, 70 = chelicera of male, 71 – 73 = epistomes of female, 74 – 76 = epistomes of male. of z 6. Glands gds 1 (po 1) situated posterior to insertions of s 1; gdj 4 (po 2) situated below line connecting j 4 and z 4, equidistantly; gds 4 (po 3) lateral to line connecting s 4 and s 5, near s 5. Anterior surface of podonotal shield covered by scales possessing lacy posterior margin, a small area of the posterocentral surface without ornamentation. Opisthonotumwith 22 pairsofsetae: J 1 – 5, Z 1 – 5 andS 1 – 5, marginalR-serieswith sevenpairsofsetae. SetaeJ 1 – 5, Z 1 – 4 andS 2 – 5 similarinappearance, smooth, pointed, needle-like. SetaeJ 2 reachinginsertionsofJ 3, J 3 reachingJ 4, otherJ-setaenotreaching basesofthefollowingoneoftheseries. SetaeJ 5 situatedonlevelofcentraldorsalcavities. Setae Z 4 situated somewhat medial to line connecting Z 3 and S 5. Setae S 2 situated anterior toS 3. SetaeZ 5, S 1 andR 1 – 6 brush-like, denselypilose, R 7 somewhatshorterthanprevious setae, bent, pointed, pilose. NoneofS-setaereachingbeyondmarginsofopisthonotum. LengthofopisthonotalsetaeanddistancesbetweentheirinsertionsasinTable 9. Glands gdZ 1 (Po 1) situatedanteromedialtoinsertionsofZ 1; gdS 2 (Po 2) situatedlateraltolineconnecting S 2 and S 3, equidistantly; glands Po 3 on line connecting J 3 and J 4; gdS 5 (Po 4) on lineconnectingJv 5 andS 5, equidistantly. Marginalserrationdeep, obtuse. Opisthonotal surfacewithoutornamentation. Posterodorsalcavitiesuniform, weaklydeveloped. Lateral pairofcavitiessituatedanteriortocentralpair, betweeninsertionsofJ 5 andZ 4. Ventralside (Fig. 78). Peritrematalandventrianalshieldsfusedwithbodymargins. Posterolateraltipsofperitrematalshieldsfusedwithlateralpartsofventrianalshieldon levelofsetaeR 3. Ornamentationofperitrematalshieldsweaklydeveloped. Peritremes finelycurved, withasmalldilationnearstigmata. Peritrematalsetaer 1 andr 3 short, smoothandneedle-like. Tritosternumwithtwoslender, apicallybifurcate, marginallypi- loselaciniae, tritosternalbasevase-like. Sternalshield 53 μmlongand 35 μmwideatthe levelofsetaest 2, withnearlystraightposteriormargin, withweaklydevelopedreticulate ornamentation. Sternalsetaesmoothandneedle-like. Glands gv 1 situatedmedialtosetaest 3. Genitalshieldtypicalforthefamily, withafewsutures, genitalsetaesmoothand needle-like. Glands gv 2 present, withdoubleopeningssurroundedbysmalladgenitalsclerites. Ventrianalshieldwithsmoothandneedle-likesetae, setaeZv 1 absent. Adanalsetae, Jv 3 – 4 andpostanalseta 1.5 – 2 timeslongerthanotherpreanalsetae. SetaeJv 5 moderately long, brush-like, denselypilose. Analvalveswithvestigialeuanalsetae. Glands gv 3 situatedlateralorslightlyanterolateraltoadanalsetae. Anteriorsurfaceofventrianalshield coveredbytile-likepatterntolevelofJv 3 – Zv 4. Gnathosoma. Situationofhypostomalandsubcapitularsetaetypicalforthefamily. Setae h 1 elongate, apically tapering, smooth. Setae h 2 shorter than h 1, h 3 shorter than h 2, eachsmooth. Setaeh 4 slightlylongerthanh 2, proximallyserrate. Corniculihorn-like, internalmalaewithapairofbifurcateanterocentralbranchesandwithserratemargins. Chelicerae (Fig. 79) relativelyslender, fixeddigitwith 5 – 6 teeth, movabledigitwith 4 – 5 teeth. Epistome of Prozercon - type (Fig. 80). Etymology. The name of the new species refers to its smooth dorsal setae and the smoothopisthonotalshield.	en	Ujvári, Zs. (2013): Review Of The Nearctic Genera Macrozercon Błaszak, 1976 And Microzercon Błaszak, 1976 (Mesostigmata: Zerconidae). Acta Zoologica Academiae Scientiarum Hungaricae 59 (4): 347-389, DOI: 10.5281/zenodo.5736238
03CB878E650A511BFD78FA4B8179BD2A.taxon	description	(Figs 81 – 85) Typematerial. USA, WestVirginia, GreenbrierCo., SummitLake, 1035 ma. s. l., 15 km E. Richwood, ex. deciduouslitter & mossonrottingwood-humussubstrate, 02.08.1986, leg. Lindquist, E. E. (slideCNCAZ 0632 – 1 female; slideCNCAZ 634 – 1 protonymph); USA, WestVirginia, PocahontasCo., HillsCreekFallsarea, 27 kmE. Richwood, 915 ma. s. l., ex. deciduouslitter, rottenwood, moss & substrate, 03.08.1986, leg. Lindquist, E. E. (slide CNCAZ 0639 – 1 male). Diagnosis of female. Setae j 1 – 3, z 2, z 6 and s 5 pilose, other central and submarginalpodonotalsetaesmooth. Eachopisthonotalsetaedenselypilose, feathered. NoneofJ-, Z-orS-setaereachinginsertionsofthefollowingsetae oftheseries. GlandsPo 2 inposition gdS 2, lateraltoS 3, Po 3 inposition gdJ 3, situatedposterolateraltoJ 3. Anteriorsurfaceofopisthonotumreticulate, with pitsofmoderatesizeinthecrossingpoints, posteriorsurfacewithahexagonal patternofclover- shapedpits. Posterodorsalcavitiesunifrom, weaklydeveloped, withundulateinnermargin. Posterolateraltipsofperitrematalshields fusedwithventrianalshieldonlevelofsetaeR 5. Descriptionoffemale. Lengthofidiosoma: 382 μm; width: 312 μm (n = 1). Dorsal side (Fig. 81). Podonotum with 20 pairs of setae, j 1 – 6, z 2 – 6, s 1 – 6, r 2 and r 4 – 5 inserteddorsally, r 1 andr 3 insertedventrally, onperitrematalshields. Setaej 1 – 3, z 2 – 3, z 6, r 2, s 3, r 4 – 5 ands 5 – 6 moderatelylong, pilose, feathered. Setaes 2 similarinappearanceto previoussetae, butshort. Otherpodonotalsetaeshort, smoothandneedle-like. Setaes 5 situatedonlevelofz 6. Glands gds 1 (po 1) situatedanteromedialtoinsertionsofs 1; gdj 4 (po 2) situated below line connecting j 4 and z 4; gds 4 (po 3) on line connecting s 4 and z 6, nears 4. Anteriorandlateralsurfaceofpodonotalshieldcoveredbyscalespossessinglacy posteriormargin, centralandposteriorsurfacewithreticulatepattern, possessingpitsof moderatesizeinthecrossingpoints. Opisthonotumwith 22 pairsofsetae: J 1 – 5, Z 1 – 5 andS 1 – 5, marginalR-serieswith sevenpairsofsetae. Eachopisthonotalsetaesimilarinappearance, denselypilose, feathered, noneofthemreachinginsertionsofthefollowingoneoftheseries. SetaeJ 5 situated slightlyabovelevelofcentralposterodorsalcavities. SetaeZ 3 – 4 finelyshiftedtowardsthe J-series, Z 4 situatedon, orsomewhatlateraltolineconnectingZ 3 andJ 5. SetaeS 2 situated anteriortoS 3. SetaeS 2 – 4 notreachingbeyondmarginsofopisthonotum. SetaeS 5 longer thantherestofcentralandsubmarginalopisthonotalsetae, expandingbeyondmarginsof idiosoma. R-setaeslightlydecreasinginlengthposteriorly. Lengthofopisthonotalsetae anddistancesbetweentheirinsertionsasinTable 10. Glands gdZ 1 (Po 1) situatedanteromedialtoinsertionsofZ 1; gdS 2 (Po 2) situatedlateraltoS 3; glands gdJ 3 (Po 3) posterolateral toJ 3; gdS 5 (Po 4) onlineconnectingZ 5 andS 5, anteriororanteromedialtoinsertionsofJv 5. Marginalserrationdeep, obtuse. AnteriorsurfaceofopisthonotumreticulatetothelineJ 2 – Z 2 – S 4, withpitsofmoderatesizeinthecrossingpoints, posteriorsurfacewithahexagonal patternofsubtriangularandclover- shapedpits. Posterodorsalcavitiesuniform, weakly developed, withundulateinnermargin. Lateralpairofcavitiessituatedanterolateralto centralpair, betweeninsertionsofJ 5 andS 5. Ventralside (Fig. 82). Peritrematalandventrianalshieldsfusedwithbodymargins. Posterolateraltipsofperitrematalshieldsfusedwithlateralpartsofventrianalshieldon levelofsetaeR 5. Peritrematalshieldsornamentedbyreticulationoflongitudinalsutures. Peritremesslightlybent, withasmalldilationnearstigmata. Peritrematalsetaer 1 andr 3 short, smoothandbristle-like. Tritosternumwithtwoslender, apicallybifurcate, marginallypiloselaciniae, tritosternalbaseproximallysubrectangular. Sternalshield 52 μmlong and 43 μmwideatthelevelofsetaest 2, witharcuateposteriormarginanddistinct, reticulateornamentation. Sternalsetaesmoothandneedle-like. Glands gv 1 situatedmedialtosetaest 3. Genitalshieldtypicalforthefamily, withirregularornamentationofsutures, geni- talsetaesmoothandneedle-like. Glands gv 2 present, withdoubleopeningssurrounded bysmalladgenitalsclerites. Ventrianalshieldwithsmoothsetae, setaeZv 1 absent. Adanal setae, Jv 3 – 4 andpostanalseta 2 timeslongerthanotherpreanalsetae. SetaeJv 5 moderately long, denselypilose, feathered. Analvalveswithvestigialeuanalsetae. Glands gv 3 situated anterolateraltoadanalsetae. Anteriorsurfaceofventrianalshieldcoveredbytile-likepattern to level of adanal setae and Jv 4. Gnathosoma. Situationofhypostomalandsubcapitularsetaetypicalforthefamily. Setae h 1 elongate, smooth. Setae h 2 - 3 shorter than h 1, smooth, h 4 longer than previ- oussetae, serrate. Corniculihorn-like, internalmalaewithapairofbifurcateanterocentral branchesandwithserratemargins. Cheliceraerelativelyslender, fixeddigitwith 6 teeth, movabledigitwith 4 – 5 teeth. Epistomeof Prozercon - type. Descriptionofmale (Fig. 83). Lengthofidiosoma: 264 μm; width: 220 μm (n = 1). Chaetotaxy, adenotaxyandsculpturalpatternofdorsal, ventrianalandperitrematalshields similartothoseoffemale. Lengthofopisthonotalsetaeanddistancesbetweentheirinser- tionsasinTable 10. Peritrematalshieldsfusedwithanterolateralpartsofventrianalshield, onlyapairofhorizontalincisionscanbeobservedrunningtowardssetaeR 2. Peritrematal dilationnearstigmatarelativelylarge. Sternigenitalshieldundivided, bearingfourpairs ofsmoothandneedle-likesetae, setaest 5 vestigial. Sternalsetaest 3 situatedonlevelofanteriorpartofgenitalopening. Anteriorsurfaceofsternigentialshieldpossessingreticulate ornamentation, posteriorsurfacewithirregularpattern. Glands gv 2 withasingleopening, surroundedbysmalladgenitalsclerites. Eachcharactersofgnathosomasimilartothoseof female, butterminalpartoffixeddigitofcheliceraebifurcate. Descriptionofprotonymph (Fig. 84). Lengthofidiosoma: 312 μm; width: 258 μm (n = 1). Podonotal setae j 1, z 4, s 4 – 5 and r 2 elongate, densely pilose, feathered. Setae j 3 and z 2 similarinshapetoformersetae, butshorter. Setaej 2 shorterthansetaej 3, barbed. Pos- teromarginalsetaer 5 ands 6 bristle-like, barbed. Setaej 4 – 6 andz 5 smoothandneedle-like. Glands gds 1 (po 1) situatedposteromedialtoj 2; gdj 4 (po 2) positionedbelowlineconnectingz 4 andj 4, equidistantly; gds 4 (po 3) inthecentreofthetriangles 4 - z 5 - s 5. Anteriorand lateralsurfaceofpodonotalshieldcoveredbyscalespossessinglacyposteriormargin, centralandposteriorsurfacewithreticulatepattern. Onopisthonotum, setaeJ 1 – 2, J 4 andZ 4 short, barbed. SetaeJ 3, J 5 andZ 1 – 3 short, smooth, needle-like. SetaeJ 5 positionedbetween lateralandcentralposterodorsalcavities. SetaeZ 5, S 2 – 5 andJv 5 elongate, denselypilose, feathered. LengthofopisthonotalsetaeanddistancesbetweentheirinsertionsasinTable 10. Glands gdJ 3 (Po 3) situatedposterolateraltosetaeJ 3, otheropisthonotalporesnotvis- ible. Posterodorsalcavitiesround, weaklydeveloped, withundulateinnermargin. AnteriorsurfaceofopisthonotumreticulatetothelineJ 4 – Z 3 – S 4, withirregularpitsofmoderate sizeinthecrossingpoints, posteriorsurfacecoveredbyirregularpits. Eachcharactersof gnathosomasimilartothoseofadults (Fig. 85). Etymology. Thenameofthenewspeciesreferstothesimilarityinthecuticularornamentation of this mite and the pattern of a leopard.	en	Ujvári, Zs. (2013): Review Of The Nearctic Genera Macrozercon Błaszak, 1976 And Microzercon Błaszak, 1976 (Mesostigmata: Zerconidae). Acta Zoologica Academiae Scientiarum Hungaricae 59 (4): 347-389, DOI: 10.5281/zenodo.5736238
